Thermo Fisher Scientific HTRA1 Polyclonal Antibody
HTRA1 단백질을 인식하는 Thermo Fisher Scientific의 폴리클로날 항체로, Western blot 및 IHC(P)에서 검증됨. 사람, 마우스, 랫트에 반응하며, 항원 친화 크로마토그래피로 정제됨. 세포 성장 및 TGF-β 신호 조절 연구에 적합.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence of human HTRA1 (QLRAASRRSERLHRPPVIVLQRGACGQGQEDPNSLRHKYNFIAD) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Wet ice |
| RRID | AB_2746535 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
HtrA1 is a 51 kDa protein and a member of the highly conserved mammalian HtrA serine protease family. It is a human homolog of bacterial HtrA and contains:
- A secretory signal sequence
- An IGFBP-binding domain
- A Kazal-type serine-protease inhibitor domain at the N-terminus
- A conserved trypsin-like serine/protease domain and a PDZ domain at the C-terminus
HtrA1 regulates cell growth and inhibits signaling mediated by TGF-beta family members. It is up-regulated in the placenta during pregnancy, playing a role in implantation and placental physiology. It regulates IGF availability by cleaving IGF-binding proteins, acts as a tumor suppressor, and is down-regulated in ovarian cancers and melanomas. Its role is also implicated in osteoarthritis, suggesting therapeutic potential. Northern blot analysis shows high expression in placenta.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific HYAL3 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific HSPE1 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific HTRA1 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific Perlecan Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific HSP105 Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|