CacheBy
Thermo Fisher Scientific HTRA1 Polyclonal Antibody
원본

Thermo Fisher Scientific HTRA1 Polyclonal Antibody

상품 한눈에 보기

HTRA1 단백질을 인식하는 Thermo Fisher Scientific의 폴리클로날 항체로, Western blot 및 IHC(P)에서 검증됨. 사람, 마우스, 랫트에 반응하며, 항원 친화 크로마토그래피로 정제됨. 세포 성장 및 TGF-β 신호 조절 연구에 적합.

판매단위
pk
카탈로그 보기

카탈로그

1개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 02. 오후 01:10
Thermo Fisher Scientific PA579419 HTRA1 Polyclonal Antibody 100 ug pk판매 단위 pk ·
재고 확인 필요
568,000원VAT 포함 624,800원

Thermo Fisher Scientific · Thermo Fisher Scientific HTRA1 Polyclonal Antibody

Applications and Tested Dilution

Application Tested Dilution
Western Blot (WB) 0.1–0.5 µg/mL
Immunohistochemistry (Paraffin) (IHC (P)) 0.5–1 µg/mL

Product Specifications

항목 내용
Species Reactivity Human, Mouse, Rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen A synthetic peptide corresponding to a sequence of human HTRA1 (QLRAASRRSERLHRPPVIVLQRGACGQGQEDPNSLRHKYNFIAD)
Conjugate Unconjugated
Form Lyophilized
Concentration 500 µg/mL
Purification Antigen affinity chromatography
Storage Buffer PBS with 4 mg trehalose
Contains 0.05 mg sodium azide
Storage Conditions -20°C
Shipping Conditions Wet ice
RRID AB_2746535

Product Specific Information

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

Target Information

HtrA1 is a 51 kDa protein and a member of the highly conserved mammalian HtrA serine protease family. It is a human homolog of bacterial HtrA and contains:

  • A secretory signal sequence
  • An IGFBP-binding domain
  • A Kazal-type serine-protease inhibitor domain at the N-terminus
  • A conserved trypsin-like serine/protease domain and a PDZ domain at the C-terminus

HtrA1 regulates cell growth and inhibits signaling mediated by TGF-beta family members. It is up-regulated in the placenta during pregnancy, playing a role in implantation and placental physiology. It regulates IGF availability by cleaving IGF-binding proteins, acts as a tumor suppressor, and is down-regulated in ovarian cancers and melanomas. Its role is also implicated in osteoarthritis, suggesting therapeutic potential. Northern blot analysis shows high expression in placenta.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

Thermo Fisher Scientific 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.