Thermo Fisher Scientific HTRA1 Polyclonal Antibody
HTRA1 단백질을 인식하는 Thermo Fisher Scientific의 폴리클로날 항체로, Western blot 및 IHC(P)에서 검증됨. 사람, 마우스, 랫트에 반응하며, 항원 친화 크로마토그래피로 정제됨. 세포 성장 및 TGF-β 신호 조절 연구에 적합.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific HTRA1 Polyclonal Antibody
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence of human HTRA1 (QLRAASRRSERLHRPPVIVLQRGACGQGQEDPNSLRHKYNFIAD) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Wet ice |
| RRID | AB_2746535 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
HtrA1 is a 51 kDa protein and a member of the highly conserved mammalian HtrA serine protease family. It is a human homolog of bacterial HtrA and contains:
- A secretory signal sequence
- An IGFBP-binding domain
- A Kazal-type serine-protease inhibitor domain at the N-terminus
- A conserved trypsin-like serine/protease domain and a PDZ domain at the C-terminus
HtrA1 regulates cell growth and inhibits signaling mediated by TGF-beta family members. It is up-regulated in the placenta during pregnancy, playing a role in implantation and placental physiology. It regulates IGF availability by cleaving IGF-binding proteins, acts as a tumor suppressor, and is down-regulated in ovarian cancers and melanomas. Its role is also implicated in osteoarthritis, suggesting therapeutic potential. Northern blot analysis shows high expression in placenta.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.