
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-BDNF Antibody
상품 한눈에 보기
Human BDNF를 인식하는 Rabbit Polyclonal Antibody로, 뇌유래신경영양인자 연구에 적합합니다. PrEST 항원 기반으로 정제되었으며 ICC 등 다양한 응용에 사용 가능합니다. 고순도 IgG, PBS/glycerol buffer로 안정화되어 있습니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
ADADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기Atlas Antibodies HPA056104-100 Anti-BDNF Antibody, brain-derived neurotrophic factor 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA056104-25 Anti-BDNF Antibody, brain-derived neurotrophic factor 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-BDNF Antibody
Anti-BDNF Antibody
Target Information
- Target Protein: Brain-derived neurotrophic factor (BDNF)
- Target Gene: BDNF
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
KTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSK
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Mouse (ENSMUSG00000048482): 100%
- Rat (ENSRNOG00000047466): 100%
Product Description
Polyclonal Antibody against Human BDNF
Open Datasheet
Recommended Applications
- Immunocytochemistry (ICC)
Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
- Material Safety Data Sheet (MSDS)
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



