
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-BDH2 Antibody
상품 한눈에 보기
인간 BDH2 단백질에 특이적인 폴리클로날 항체로, IHC 분석 및 RNA-seq 데이터 비교를 통한 정교한 단백질 발현 검증에 적합. 토끼 유래 IgG 항체이며, PrEST 항원으로 친화 정제됨. Human, Mouse, Rat 종에 반응.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
ADADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기Atlas Antibodies HPA036028-100 Anti-BDH2 Antibody, 3-hydroxybutyrate dehydrogenase, type 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA036028-25 Anti-BDH2 Antibody, 3-hydroxybutyrate dehydrogenase, type 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-BDH2 Antibody
Anti-BDH2 Antibody
Target Information
- Protein: 3-hydroxybutyrate dehydrogenase, type 2
- Gene: BDH2
- Alternative Gene Names: DHRS6, FLJ13261, PRO20933, SDR15C1, UCPA-OR, UNQ6308
Product Description
Polyclonal antibody against human BDH2.
Validated orthogonally using IHC and RNA-seq data comparison across tissues with high and low expression.
Antigen Information
- Antigen Sequence:
CPGTVDTPSLQERIQARGNPEEARNDFLKRQKTGRFATAEEIAMLCVYLASDESAYVTGNPVIIDGGWSL
(Recombinant Protein Epitope Signature Tag, PrEST antigen sequence)
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000028167 | 87% |
| Rat | ENSRNOG00000014490 | 83% |
Antibody Characteristics
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
| Buffer Composition | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative |
| Safety Data Sheet | Material Safety Data Sheet |
Usage Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Recommended Applications
- Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Additional Resources
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



