CacheBy
Atlas Antibodies Anti-BDH2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-BDH2 Antibody

상품 한눈에 보기

인간 BDH2 단백질에 특이적인 폴리클로날 항체로, IHC 분석 및 RNA-seq 데이터 비교를 통한 정교한 단백질 발현 검증에 적합. 토끼 유래 IgG 항체이며, PrEST 항원으로 친화 정제됨. Human, Mouse, Rat 종에 반응.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA036028-100 Anti-BDH2 Antibody, 3-hydroxybutyrate dehydrogenase, type 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA036028-25 Anti-BDH2 Antibody, 3-hydroxybutyrate dehydrogenase, type 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-BDH2 Antibody

Anti-BDH2 Antibody

Target Information

  • Protein: 3-hydroxybutyrate dehydrogenase, type 2
  • Gene: BDH2
  • Alternative Gene Names: DHRS6, FLJ13261, PRO20933, SDR15C1, UCPA-OR, UNQ6308

Product Description

Polyclonal antibody against human BDH2.
Validated orthogonally using IHC and RNA-seq data comparison across tissues with high and low expression.

Antigen Information

  • Antigen Sequence:
    CPGTVDTPSLQERIQARGNPEEARNDFLKRQKTGRFATAEEIAMLCVYLASDESAYVTGNPVIIDGGWSL
    (Recombinant Protein Epitope Signature Tag, PrEST antigen sequence)

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000028167 87%
Rat ENSRNOG00000014490 83%

Antibody Characteristics

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using PrEST antigen as affinity ligand
Buffer Composition 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative
Safety Data Sheet Material Safety Data Sheet

Usage Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.
  • Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Additional Resources

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.