
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-BBS1 Antibody
상품 한눈에 보기
인간 BBS1 단백질을 인식하는 폴리클로날 항체로 Bardet-Biedl 증후군 연구에 적합. 토끼에서 생산된 IgG 형식으로 PrEST 항원으로 정제됨. IHC 등 다양한 응용에 사용 가능하며, 인간에 대해 검증됨.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA058283-100 Anti-BBS1 Antibody, Bardet-Biedl syndrome 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA058283-25 Anti-BBS1 Antibody, Bardet-Biedl syndrome 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-BBS1 Antibody
Anti-BBS1 Antibody
Target Information
- Target Protein: Bardet-Biedl syndrome 1
- Target Gene: BBS1
- Alternative Gene Names: FLJ23590
Product Description
Polyclonal antibody against human BBS1.
Recommended for applications such as immunohistochemistry (IHC).
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Antigen Sequence:
IQSLRFLQLELSEMEAFVNQHKSNSIKRQTVITTMTTLKKNLADEDAVSCLVLGTENKELLVLDPEAFTILAKMSLPSVPVFLEVSGQFDVEFRLA
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Rat: ENSRNOG00000019832 (94%)
- Mouse: ENSMUSG00000006464 (94%)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



