CacheBy
Atlas Antibodies Anti-BBS1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-BBS1 Antibody

상품 한눈에 보기

인간 BBS1 단백질을 인식하는 폴리클로날 항체로 Bardet-Biedl 증후군 연구에 적합. 토끼에서 생산된 IgG 형식으로 PrEST 항원으로 정제됨. IHC 등 다양한 응용에 사용 가능하며, 인간에 대해 검증됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA058283-100 Anti-BBS1 Antibody, Bardet-Biedl syndrome 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA058283-25 Anti-BBS1 Antibody, Bardet-Biedl syndrome 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-BBS1 Antibody

Anti-BBS1 Antibody

Target Information

  • Target Protein: Bardet-Biedl syndrome 1
  • Target Gene: BBS1
  • Alternative Gene Names: FLJ23590

Product Description

Polyclonal antibody against human BBS1.
Recommended for applications such as immunohistochemistry (IHC).

Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • Antigen Sequence:
    IQSLRFLQLELSEMEAFVNQHKSNSIKRQTVITTMTTLKKNLADEDAVSCLVLGTENKELLVLDPEAFTILAKMSLPSVPVFLEVSGQFDVEFRLA

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat: ENSRNOG00000019832 (94%)
  • Mouse: ENSMUSG00000006464 (94%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Open Datasheet

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.