CacheBy
Atlas Antibodies Anti-BBOX1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-BBOX1 Antibody

상품 한눈에 보기

Human BBOX1 단백질을 인식하는 고품질 폴리클로날 항체. IHC 및 WB 실험에 적합하며 RNA-seq 데이터 기반 Orthogonal Validation 지원. Rabbit 호스트, IgG 아이소타입, Affinity purified 방식으로 높은 특이성과 재현성 제공.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA007600-100 Anti-BBOX1 Antibody, butyrobetaine (gamma), 2-oxoglutarate dioxygenase (gamma-butyrobetaine hydroxylase) 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA007600-25 Anti-BBOX1 Antibody, butyrobetaine (gamma), 2-oxoglutarate dioxygenase (gamma-butyrobetaine hydroxylase) 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-BBOX1 Antibody

Anti-BBOX1 Antibody

Target Protein: butyrobetaine (gamma), 2-oxoglutarate dioxygenase (gamma-butyrobetaine hydroxylase) 1
Supplier: Atlas Antibodies


  • IHC Orthogonal Validation: 단백질 발현을 RNA-seq 데이터와 비교하여 검증
  • WB (Western Blot)

Product Description

Polyclonal Antibody against Human BBOX1


Alternative Gene Names

BBH, BBOX, G-BBH, gamma-BBH

Open Datasheet


Specifications

항목 내용
Target Protein butyrobetaine (gamma), 2-oxoglutarate dioxygenase (gamma-butyrobetaine hydroxylase) 1
Target Gene BBOX1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000059519 (95%), Mouse ENSMUSG00000041660 (94%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용에 대한 최적 농도 및 조건은 사용자가 직접 결정해야 합니다.

Antigen Sequence

DANNVAYTTGKLSFHTDYPALHHPPGVQLLHCIKQTVTGGDSEIVDGFNVCQKLKKNNPQAFQILSSTFVDFTDIGVDYCDFSVQSKHKIIELDDKGQVVRINFNNATRDTIFDVPVERVQPFYAALKEFVDLMNSKESKLT

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Validation Tooltip
Western Blot

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.