
Atlas Antibodies Anti-BASP1 Antibody
Human BASP1 단백질을 인식하는 polyclonal antibody로, IHC, WB, ICC 등 다양한 실험에 사용 가능. RNA-seq 데이터 기반 orthogonal validation 완료. Rabbit host, IgG isotype, PrEST 항원으로 정제된 고품질 항체.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-BASP1 Antibody
Full name: brain abundant, membrane attached signal protein 1 (BASP1)
Recommended Applications
IHC (Immunohistochemistry)
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.WB (Western Blot)
Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.ICC (Immunocytochemistry)
Product Description
Polyclonal antibody against Human BASP1.
Alternative Gene Names
CAP-23, CAP23, NAP-22, NAP22
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | brain abundant, membrane attached signal protein 1 |
| Target Gene | BASP1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | MGGKLSKKKKGYNVNDEKAKEKDKKAEGAATEEEGTPKESEP |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000045763 (95%), Rat ENSRNOG00000046313 (93%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 항목 | 내용 |
|---|---|
| Composition | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-BASP1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-BARHL1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-BASP1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-BANP Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-BARX2 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|