Atlas Antibodies Anti-BASP1 Antibody

상품 한눈에 보기

Human BASP1 단백질을 인식하는 고품질 폴리클로날 항체로, IHC 및 WB에서 RNA-seq 데이터 기반 Orthogonal 검증 완료. Rabbit 유래 IgG 항체로 높은 특이성과 재현성을 제공하며, 인체 BASP1 단백질 연구에 적합.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA050333-100 Anti-BASP1 Antibody, brain abundant, membrane attached signal protein 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA050333-25 Anti-BASP1 Antibody, brain abundant, membrane attached signal protein 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-BASP1 Antibody

Anti-BASP1 Antibody

Target: brain abundant, membrane attached signal protein 1 (BASP1)
Type: Polyclonal Antibody against Human BASP1
Supplier: Atlas Antibodies

Recommended Applications

IHC (Immunohistochemistry): Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
WB (Western Blot): Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
ICC (Immunocytochemistry)

Product Description

Polyclonal antibody specifically targeting human BASP1 protein.

Alternative Gene Names

CAP-23, CAP23, NAP-22, NAP22

Target Information

항목	내용
Target Protein	brain abundant, membrane attached signal protein 1
Target Gene	BASP1
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Antigen Sequence Detail	MGGKLSKKKKGYNVNDEKAKEKDKKAEGAATEEEGTPKESEP
Verified Species Reactivity	Human
Interspecies Information	Mouse ENSMUSG00000045763 (95%), Rat ENSRNOG00000046313 (93%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand