
1 / 2
Atlas Antibodies Anti-BASP1 Antibody
상품 한눈에 보기
Human BASP1 단백질을 인식하는 고품질 폴리클로날 항체로, IHC 및 WB에서 RNA-seq 데이터 기반 Orthogonal 검증 완료. Rabbit 유래 IgG 항체로 높은 특이성과 재현성을 제공하며, 인체 BASP1 단백질 연구에 적합.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-BASP1 Antibody
Target: brain abundant, membrane attached signal protein 1 (BASP1)
Type: Polyclonal Antibody against Human BASP1
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Immunohistochemistry): Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
- WB (Western Blot): Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
- ICC (Immunocytochemistry)
Product Description
Polyclonal antibody specifically targeting human BASP1 protein.
Alternative Gene Names
CAP-23, CAP23, NAP-22, NAP22
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | brain abundant, membrane attached signal protein 1 |
| Target Gene | BASP1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Antigen Sequence Detail | MGGKLSKKKKGYNVNDEKAKEKDKKAEGAATEEEGTPKESEP |
| Verified Species Reactivity | Human |
| Interspecies Information | Mouse ENSMUSG00000045763 (95%), Rat ENSRNOG00000046313 (93%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
- Material Safety Data Sheet (MSDS)
Related Documents
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.




