CacheBy
Atlas Antibodies Anti-BAG3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-BAG3 Antibody

상품 한눈에 보기

인간 BAG3 단백질을 표적으로 하는 고품질 폴리클로날 항체. IHC 및 ICC 등 다양한 응용에 적합하며, 독립 항체 검증으로 높은 신뢰성 확보. Rabbit에서 생산된 IgG 형 항체로 PrEST 항원 기반 친화 정제 수행.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA018493-100 Anti-BAG3 Antibody, BCL2-associated athanogene 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA018493-25 Anti-BAG3 Antibody, BCL2-associated athanogene 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-BAG3 Antibody

Anti-BAG3 Antibody

BCL2-associated athanogene 3


  • IHC (Independent validation)
    Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
  • ICC

Product Description

Polyclonal Antibody against Human BAG3
Open Datasheet (PDF)


Target Information

항목 내용
Target Protein BCL2-associated athanogene 3
Target Gene BAG3
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence DSVDPEGRADVRQARRDGVRKVQTILEKLEQKAIDVPGQVQVYELQPSNLEADQPLQAIMEMGAVAADKGKKNAGNAEDPHTETQQPEATAAATSNPSSMTDTPGNPAAP

Verified Species Reactivity

Species Reactivity
Human Verified
Rat 80% sequence identity (ENSRNOG00000020298)
Mouse 77% sequence identity (ENSMUSG00000030847)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Independent
Independent Validation Tooltip
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.