
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-BAG3 Antibody
상품 한눈에 보기
인간 BAG3 단백질을 표적으로 하는 고품질 폴리클로날 항체. IHC 및 ICC 등 다양한 응용에 적합하며, 독립 항체 검증으로 높은 신뢰성 확보. Rabbit에서 생산된 IgG 형 항체로 PrEST 항원 기반 친화 정제 수행.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA018493-100 Anti-BAG3 Antibody, BCL2-associated athanogene 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA018493-25 Anti-BAG3 Antibody, BCL2-associated athanogene 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-BAG3 Antibody
Anti-BAG3 Antibody
BCL2-associated athanogene 3
Recommended Applications
- IHC (Independent validation)
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. - ICC
Product Description
Polyclonal Antibody against Human BAG3
Open Datasheet (PDF)
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | BCL2-associated athanogene 3 |
| Target Gene | BAG3 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | DSVDPEGRADVRQARRDGVRKVQTILEKLEQKAIDVPGQVQVYELQPSNLEADQPLQAIMEMGAVAADKGKKNAGNAEDPHTETQQPEATAAATSNPSSMTDTPGNPAAP |
Verified Species Reactivity
| Species | Reactivity |
|---|---|
| Human | Verified |
| Rat | 80% sequence identity (ENSRNOG00000020298) |
| Mouse | 77% sequence identity (ENSMUSG00000030847) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



