
Atlas Antibodies Anti-BAG3 Antibody
상품 한눈에 보기
인간 BAG3 단백질을 표적으로 하는 고품질 폴리클로날 항체. IHC 및 ICC 등 다양한 응용에 적합하며, 독립 항체 검증으로 높은 신뢰성 확보. Rabbit에서 생산된 IgG 형 항체로 PrEST 항원 기반 친화 정제 수행.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-BAG3 Antibody
BCL2-associated athanogene 3
Recommended Applications
- IHC (Independent validation)
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. - ICC
Product Description
Polyclonal Antibody against Human BAG3
Open Datasheet (PDF)
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | BCL2-associated athanogene 3 |
| Target Gene | BAG3 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | DSVDPEGRADVRQARRDGVRKVQTILEKLEQKAIDVPGQVQVYELQPSNLEADQPLQAIMEMGAVAADKGKKNAGNAEDPHTETQQPEATAAATSNPSSMTDTPGNPAAP |
Verified Species Reactivity
| Species | Reactivity |
|---|---|
| Human | Verified |
| Rat | 80% sequence identity (ENSRNOG00000020298) |
| Mouse | 77% sequence identity (ENSMUSG00000030847) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.
