CacheBy
Atlas Antibodies Anti-BAG3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-BAG3 Antibody

상품 한눈에 보기

Human BAG3 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 ICC 등에서 사용 가능. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성 제공. 인간 시료에 검증됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA020586-100 Anti-BAG3 Antibody, BCL2-associated athanogene 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA020586-25 Anti-BAG3 Antibody, BCL2-associated athanogene 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-BAG3 Antibody

Anti-BAG3 Antibody

BCL2-associated athanogene 3


  • IHC (Immunohistochemistry) – Independent antibody validation: 단백질의 서로 다른 epitope을 타깃으로 하는 항체 간 비교를 통해 IHC에서 단백질 발현 검증
  • ICC (Immunocytochemistry)

Product Description

Polyclonal Antibody against Human BAG3

Open Datasheet


Target Information

항목 내용
Target Protein BCL2-associated athanogene 3
Target Gene BAG3
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence DSVDPEGRADVRQARRDGVRKVQTILEKLEQKAIDVPGQVQVYELQPSNLEADQPLQAIMEMGAVAADKGKKNAGNAEDPHTETQQPEATAAATSNPSSMTDTPGNPAAP
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000020298 (80%), Mouse ENSMUSG00000030847 (77%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide preservative 포함. Material Safety Data Sheet
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용 분야에 대한 최적의 농도 및 조건은 사용자가 직접 결정해야 합니다.

제품 이미지

Enhanced Validation
IHC Independent Validation
Tooltip Independent
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.