
Atlas Antibodies Anti-ATP6V1G1 Antibody
상품 한눈에 보기
인간 ATP6V1G1 단백질을 인식하는 폴리클로날 항체로, WB 및 ICC에 적합합니다. 토끼 유래 IgG 형식이며 PrEST 항원으로 정제되었습니다. 높은 종간 보존성을 보여 인간, 쥐, 생쥐에 반응합니다. 글리세롤 및 PBS 완충액에 보존되어 안정적입니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-ATP6V1G1 Antibody
ATPase, H⁺ transporting, lysosomal 13kDa, V1 subunit G1
Recommended Applications
- Western Blot (WB)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human ATP6V1G1.
Alternative Gene Names
ATP6G, ATP6G1, ATP6GL, ATP6J, DKFZp547P234, Vma10
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | ATPase, H⁺ transporting, lysosomal 13kDa, V1 subunit G1 |
| Target Gene | ATP6V1G1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Homology | Rat ENSRNOG00000008163 (95%), Mouse ENSMUSG00000039105 (92%) |
Antigen Sequence
AEIEQYRLQREKEFKAKEAAALGSRGSCSTEVEKETQEKMTILQTYFRQNRDEVLDNLLAFVCDIRPEIHENYR
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Safety Info | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-ATP6V1H Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ATP6V1G2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ATP6V1G1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ATP6V1E1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ATP6V1F Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.