Atlas Antibodies Anti-ATP6V1F Antibody
상품 옵션 정보 | |||||||||
---|---|---|---|---|---|---|---|---|---|
카탈로그 번호 | CAS 번호 | 설명 | 상태 | 재고 | 단위 | 판매가 | 할인가 | 가격(VAT포함) | 수량 / 장바구니 / 찜 |
HPA062011-100 | - | Atlas Antibodies HPA062011-100 Anti-ATP6V1F Antibody, ATPase, H+ transporting, lysosomal 14kDa, V1 subunit F 100ul | 재고문의 | 100ul | 728,000원 | - | 800,800원 | ||
HPA062011-25 | - | Atlas Antibodies HPA062011-25 Anti-ATP6V1F Antibody, ATPase, H+ transporting, lysosomal 14kDa, V1 subunit F 25ul | 재고문의 | 25ul | 528,000원 | - | 580,800원 |
다른 상품 둘러보기
Anti-ATP6V1F Antibody
ATPase, H+ transporting, lysosomal 14kDa, V1 subunit F
Recommended Applications
Product Description
Polyclonal Antibody against Human ATP6V1F
Alternative Gene Names
ATP6S14, VATF, Vma7
Target Protein
ATPase, H+ transporting, lysosomal 14kDa, V1 subunit F
Target Gene
ATP6V1F
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Copy sequence to clipboard
DTFRSLGSLPGSVVEANPNQRDPPLWDEIDSRQFL
Verified Species Reactivity
Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
Rat ENSRNOG00000054336 (37%)
Mouse ENSMUSG00000047810 (34%)
Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. [Material Safety Data Sheet](https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf Material Safety Data Sheet
)
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제 방법 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|