Atlas Antibodies Anti-ATG9A Antibody
상품 한눈에 보기
Human ATG9A 단백질을 인식하는 Rabbit Polyclonal 항체로, 자가포식 관련 단백질 연구에 적합. IHC 및 ICC 응용에 권장되며, PrEST 항원으로 친화 정제됨. 인체, 생쥐, 랫트에서 높은 교차 반응성을 보임.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-ATG9A Antibody
Target Information
- Target Protein: Autophagy related 9A
- Target Gene: ATG9A
- Alternative Gene Names: APG9L1, FLJ22169
Product Description
Polyclonal antibody against Human ATG9A, validated for use in immunohistochemistry (IHC) and immunocytochemistry (ICC).
Produced in rabbit and affinity purified using the PrEST antigen as affinity ligand.
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
- Antigen Sequence:
IYNICCYWEIHSFYLHALRIPMSALPYCTWQEVQARIVQTQKEHQICIHKRELTELD
Species Reactivity
- Verified Reactivity: Human
- Ortholog Identity:
- Mouse (ENSMUSG00000033124): 100%
- Rat (ENSRNOG00000018975): 100%
Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using PrEST antigen |
| Applications | IHC, ICC |
| Storage Notes | Gently mix before use. Optimal concentrations should be determined by the user. |
Material Safety Data Sheet (MSDS)
Open Datasheet (PDF)
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.