CacheBy
Atlas Antibodies Anti-ATG9A Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ATG9A Antibody

상품 한눈에 보기

Human ATG9A 단백질을 인식하는 Rabbit Polyclonal 항체로, 자가포식 관련 단백질 연구에 적합. IHC 및 ICC 응용에 권장되며, PrEST 항원으로 친화 정제됨. 인체, 생쥐, 랫트에서 높은 교차 반응성을 보임.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA059551-100 Anti-ATG9A Antibody, autophagy related 9A 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA059551-25 Anti-ATG9A Antibody, autophagy related 9A 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ATG9A Antibody

Anti-ATG9A Antibody

Target Information

  • Target Protein: Autophagy related 9A
  • Target Gene: ATG9A
  • Alternative Gene Names: APG9L1, FLJ22169

Product Description

Polyclonal antibody against Human ATG9A, validated for use in immunohistochemistry (IHC) and immunocytochemistry (ICC).
Produced in rabbit and affinity purified using the PrEST antigen as affinity ligand.

Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
  • Antigen Sequence:
    IYNICCYWEIHSFYLHALRIPMSALPYCTWQEVQARIVQTQKEHQICIHKRELTELD

Species Reactivity

  • Verified Reactivity: Human
  • Ortholog Identity:
    • Mouse (ENSMUSG00000033124): 100%
    • Rat (ENSRNOG00000018975): 100%

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen
Applications IHC, ICC
Storage Notes Gently mix before use. Optimal concentrations should be determined by the user.

Material Safety Data Sheet (MSDS)
Open Datasheet (PDF)

제품 이미지

IHC Application
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.