Atlas Antibodies Anti-ATG7 Antibody

상품 한눈에 보기

인간 ATG7 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산됨. 자식작용 관련 연구에 적합하며 IHC, ICC 등 다양한 응용 가능. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성 제공. Human에 검증된 반응성.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA007639-100 Anti-ATG7 Antibody, autophagy related 7 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA007639-25 Anti-ATG7 Antibody, autophagy related 7 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target Protein: Autophagy related 7
Supplier: Atlas Antibodies

Polyclonal antibody against human ATG7, produced in rabbit and affinity purified using the PrEST antigen as affinity ligand.

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

EAPKDIKGYYYNGDSAGLPARLTLEFSAFDMSAPTPARCCPAIGTLYNTNTLESFKTADKKLLLEQAANEIWESIKSGTALENPVLLNKFLLLTFADLKKYHFYYWFCYPALCLPESLPLIQGPVGLDQRFSLKQIEAL

Highest antigen sequence identity to the following orthologs:

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using PrEST antigen
Storage	Store at recommended temperature; mix gently before use
Notes	Optimal concentrations and conditions should be determined by the user