Atlas Antibodies Anti-ATL2 Antibody

상품 한눈에 보기

Human ATL2 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산된 IgG 형식입니다. Affinity purification으로 높은 특이성과 순도를 보장하며, IHC 등 다양한 연구 응용에 적합합니다. Glycerol/PBS buffer에 보존되어 안정적입니다.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA029108-100 Anti-ATL2 Antibody, atlastin GTPase 2 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA029108-25 Anti-ATL2 Antibody, atlastin GTPase 2 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-ATL2 Antibody

Anti-ATL2 Antibody

Target Information

Target Protein: Atlastin GTPase 2
Target Gene: ATL2
Alternative Gene Name: ARL6IP2

Product Description

Polyclonal antibody against human ATL2, generated in rabbit and affinity purified using the PrEST antigen as affinity ligand.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
EFREIGTVIDQIAETLWEQRSPRKVFSKLFEVTRRRMVHRALSSAQRQRLSSNNNKKK

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse (ENSMUSG00000059811): 41%
Rat (ENSRNOG00000006523): 40%

Recommended Applications

IHC (Immunohistochemistry)

Product Specifications

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using PrEST antigen
Storage Notes	Gently mix before use. Determine optimal concentrations and conditions experimentally.