Atlas Antibodies Anti-ATL2 Antibody
상품 한눈에 보기
Human ATL2 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산된 IgG 형식입니다. Affinity purification으로 높은 특이성과 순도를 보장하며, IHC 등 다양한 연구 응용에 적합합니다. Glycerol/PBS buffer에 보존되어 안정적입니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-ATL2 Antibody
Target Information
- Target Protein: Atlastin GTPase 2
- Target Gene: ATL2
- Alternative Gene Name: ARL6IP2
Product Description
Polyclonal antibody against human ATL2, generated in rabbit and affinity purified using the PrEST antigen as affinity ligand.
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:EFREIGTVIDQIAETLWEQRSPRKVFSKLFEVTRRRMVHRALSSAQRQRLSSNNNKKK
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Mouse (ENSMUSG00000059811): 41%
- Rat (ENSRNOG00000006523): 40%
Recommended Applications
IHC (Immunohistochemistry)
Product Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using PrEST antigen |
| Storage Notes | Gently mix before use. Determine optimal concentrations and conditions experimentally. |
Reference
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.