Thermo Fisher Scientific MPP1 Polyclonal Antibody
Human, Mouse, Rat 반응성의 Rabbit Polyclonal 항체로 Western blot, ICC/IF, Flow cytometry에 적합. 합성 펩타이드(C-terminus MPP1) 면역원 사용. 항원 친화 크로마토그래피로 정제된 동결건조 형태. 연구용으로 세포 신호 및 구조 연구에 활용 가능.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunocytochemistry (ICC/IF) | 2 µg/mL |
| Flow Cytometry (Flow) | 1–3 µg/1×10⁶ cells |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human MPP1 (409–450aa TEALQQLQKDSEAIRSQYAHYFDLSLVNNGVDETLKKLQEAF) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | −20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2746807 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
This gene encodes the prototype of the membrane-associated guanylate kinase (MAGUK) family proteins. MAGUKs interact with the cytoskeleton and regulate cell proliferation, signaling pathways, and intercellular junctions.
The encoded protein is an extensively palmitoylated membrane phosphoprotein containing a PDZ domain, a Src homology 3 (SH3) motif, and a guanylate kinase domain.
This gene product interacts with various cytoskeletal and junctional proteins in different tissue and cell types, and may be involved in the regulation of cell shape, hair cell development, neural patterning of the retina, apico-basal polarity, and tumor suppression pathways in non-erythroid cells.
Multiple transcript variants encoding different isoforms have been found for this gene.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific MSH2 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific Mesothelin Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific MPP1 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific MRGX1 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific MPZ Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|