
Atlas Antibodies Anti-NLK Antibody
상품 한눈에 보기
Human NLK(nemo-like kinase)를 인식하는 rabbit polyclonal antibody로, WB 및 ICC 응용에 적합. PrEST 항원을 이용해 친화 정제됨. 높은 종 간 보존성(마우스·랫 100%)을 보이며, PBS/glycerol buffer에 보존됨.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-NLK Antibody
Target: nemo-like kinase (NLK)
Clonality: Polyclonal
Host: Rabbit
Isotype: IgG
Recommended Applications
- Western Blot (WB)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human NLK (nemo-like kinase).
Affinity purified using the PrEST antigen as affinity ligand.
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | nemo-like kinase |
| Target Gene | NLK |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000008704 (100%), Mouse ENSMUSG00000017376 (100%) |
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
LRGPHKQPSLPVLYTLSSQATHEAVHLLCRMLVFDPSKRISAKDALAHPYLDEGRLRYHTCMCKCCFSTSTGRVYTSDFEPVTNPKFDDTFEKNLSSVRQVKEIIHQFILEQQKGNRVPLCINPQSAAFKSFISSTVAQPSBuffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide added as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-NLE1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NKX6-1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NLK Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NKX3-2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NKX3-1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.