
Atlas Antibodies Anti-NKX3-1 Antibody
Human NKX3-1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 Orthogonal 검증에 적합합니다. PrEST 항원으로 정제되어 높은 특이성과 재현성을 제공합니다. 인간 반응성 확인, RNA-seq 데이터 기반 검증 완료.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-NKX3-1 Antibody
NK3 homeobox 1
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human NKX3-1
Alternative Gene Names
BAPX2, NKX3.1, NKX3A
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | NK3 homeobox 1 |
| Target Gene | NKX3-1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | MLRVPEPRPGEAKAEGAAPPTPSKPLTSFLIQDILRDG |
Verified Species Reactivity
Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Mouse ENSMUSG00000022061 (67%)
- Rat ENSRNOG00000015477 (64%)
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
Buffer Composition
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-NLK Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NKX3-2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NKX3-1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NLGN3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NLGN2 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|