
Atlas Antibodies Anti-NKAIN1 Antibody
상품 한눈에 보기
Human NKAIN1 단백질을 인식하는 Rabbit Polyclonal 항체로, Na+/K+ ATPase 상호작용 단백질 연구에 적합. Affinity purification 방식으로 정제되었으며, IHC 등 다양한 응용에 사용 가능. Human에 대해 검증됨.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-NKAIN1 Antibody
Target: Na+/K+ transporting ATPase interacting 1 (NKAIN1)
Type: Polyclonal Antibody against Human NKAIN1
Recommended Applications
면역조직화학(IHC) 등 다양한 연구 응용에 적합합니다.
Product Description
Polyclonal antibody raised in rabbit against human NKAIN1 protein.
Alternative Gene Names
FAM77C, FLJ12650
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Na+/K+ transporting ATPase interacting 1 |
| Target Gene | NKAIN1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | DRDFIMTFNTSLHRSWWMENGPGCLVTPVLNSRLALEDHHVISVTGCLLDYPY |
Verified Species Reactivity
Human
Interspecies Information
| 종 | Ortholog ID | 항원 서열 동일성 |
|---|---|---|
| Rat | ENSRNOG00000011445 | 100% |
| Mouse | ENSMUSG00000106964 | 100% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 구성 성분 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- 사용 전 부드럽게 혼합하십시오.
- 최적의 농도 및 조건은 사용자가 실험 목적에 따라 결정해야 합니다.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-NKD1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NKAIN4 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NKAIN1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NKD1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NIPBL Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.