CacheBy
Atlas Antibodies Anti-NKD1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NKD1 Antibody

상품 한눈에 보기

Human NKD1 단백질을 인식하는 토끼 폴리클로날 항체로, 면역조직화학 등 다양한 연구용 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 특이성과 재현성을 제공합니다. Human에 대한 반응성이 검증되었습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA049413-100 Anti-NKD1 Antibody, naked cuticle homolog 1 (Drosophila) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA049413-25 Anti-NKD1 Antibody, naked cuticle homolog 1 (Drosophila) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NKD1 Antibody

Anti-NKD1 Antibody

Target: naked cuticle homolog 1 (Drosophila)
Gene: NKD1
Supplier: Atlas Antibodies


면역조직화학(IHC) 등 다양한 연구용 응용에 적합


Product Description

Polyclonal antibody against Human NKD1.
Open Datasheet


Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • Sequence:
    WARKGIEEWIGRQRCPGGVSGPRQLRLAGTIGRSTRELVGDVLRDTLSEEEEDDFRLEVALPPEKTDGLGSGDEKKMERVSEPCP

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to orthologs:

  • Mouse: ENSMUSG00000031661 (81%)
  • Rat: ENSRNOG00000014293 (78%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (MSDS)

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용에 대한 최적 조건은 사용자가 직접 결정해야 합니다.

제품 이미지

Recommended Applications Icon

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.