Atlas Antibodies Anti-NIPA1 Antibody
| 상품 옵션 정보 | |||||||
|---|---|---|---|---|---|---|---|
| 카탈로그 번호 | 설명 | 상태 | 단위 | 판매가 | 할인가 | 가격(VAT포함) | 수량 / 장바구니 / 찜 |
| HPA023269-100 | Atlas Antibodies HPA023269-100 Anti-NIPA1 Antibody, non imprinted in Prader-Willi/Angelman syndrome 1 100ul | 재고문의 | 100ul | 728,000원 | - | 800,800원 | |
| HPA023269-25 | Atlas Antibodies HPA023269-25 Anti-NIPA1 Antibody, non imprinted in Prader-Willi/Angelman syndrome 1 25ul | 재고문의 | 25ul | 528,000원 | - | 580,800원 | |
다른 상품 둘러보기
Anti-NIPA1 Antibody
non imprinted in Prader-Willi/Angelman syndrome 1
Recommended Applications
Product Description
Polyclonal Antibody against Human NIPA1
Alternative Gene Names
MGC35570, SPG6
Target Protein
non imprinted in Prader-Willi/Angelman syndrome 1
Target Gene
NIPA1
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Copy sequence to clipboard
HGPTNIMVYISICSLLGSFTVPSTKGIGLAAQDILHNNPSSQRA
Verified Species Reactivity
Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
Mouse ENSMUSG00000047037 (100%)
Rat ENSRNOG00000042702 (100%)
Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. [Material Safety Data Sheet](https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf Material Safety Data Sheet)
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제 방법 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|