CacheBy
Atlas Antibodies Anti-NIP7 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NIP7 Antibody

상품 한눈에 보기

Human NIP7 단백질을 인식하는 토끼 폴리클로날 항체로, WB 및 ICC 응용에 적합합니다. PrEST 항원으로 친화 정제되었으며, 높은 종간 보존성을 보입니다. 40% 글리세롤/PBS 완충액에 보존제 포함.

카탈로그번호
HPA059850-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA059850-100 Anti-NIP7 Antibody, NIP7, nucleolar pre-rRNA processing protein 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA059850-25 Anti-NIP7 Antibody, NIP7, nucleolar pre-rRNA processing protein 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NIP7 Antibody

Anti-NIP7 Antibody

Target: NIP7, nucleolar pre-rRNA processing protein
Supplier: Atlas Antibodies


  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human NIP7.


Alternative Gene Names

CGI-37, FLJ10296, HSPC031, KD93

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein NIP7, nucleolar pre-rRNA processing protein
Target Gene NIP7
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence APYAKYKVWIKPGAEQSFLYGNHVLKSGLGRITENTSQYQGVVVYSMADIPLGFGVAAKSTQDCRKVDPMAIVVFHQADIGEYVRHEETLT
Verified Species Reactivity Human
Interspecies Identity Mouse (99%), Rat (98%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Buffer Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.