
Atlas Antibodies Anti-NHSL2 Antibody
상품 한눈에 보기
Human NHSL2 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산되었습니다. Affinity purification 방식으로 정제되었으며, IHC 등 다양한 연구용 응용에 적합합니다. 40% glycerol 기반 PBS buffer에 보존되어 안정성이 우수합니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-NHSL2 Antibody
Target: NHS-like 2 (NHSL2)
Supplier: Atlas Antibodies
Product Description
Polyclonal antibody against human NHSL2 protein.
Affinity purified using the PrEST antigen as affinity ligand.
Suitable for various research applications including immunohistochemistry (IHC).
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Antigen Sequence:
STFSTSWKGDAFTYMTPSATSQSNQVNENGKNPSCGNSWVSLNKVPPLVPKEAATLLVARDNPAGCSGSAGYPERLIQQRHMPERPSKI
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | NHS-like 2 |
| Target Gene | NHSL2 |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse (75%), Rat (29%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using PrEST antigen |
| Buffer Composition | 40% glycerol, PBS (pH 7.2), 0.02% sodium azide (preservative) |
| Safety Data | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.
