
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-NHSL2 Antibody
상품 한눈에 보기
Human NHSL2 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산되었습니다. Affinity purification 방식으로 정제되었으며, IHC 등 다양한 연구용 응용에 적합합니다. 40% glycerol 기반 PBS buffer에 보존되어 안정성이 우수합니다.
- 카탈로그번호
- HPA054858-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA054858-100 Anti-NHSL2 Antibody, NHS-like 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA054858-25 Anti-NHSL2 Antibody, NHS-like 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-NHSL2 Antibody
Anti-NHSL2 Antibody
Target: NHS-like 2 (NHSL2)
Supplier: Atlas Antibodies
Product Description
Polyclonal antibody against human NHSL2 protein.
Affinity purified using the PrEST antigen as affinity ligand.
Suitable for various research applications including immunohistochemistry (IHC).
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Antigen Sequence:
STFSTSWKGDAFTYMTPSATSQSNQVNENGKNPSCGNSWVSLNKVPPLVPKEAATLLVARDNPAGCSGSAGYPERLIQQRHMPERPSKI
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | NHS-like 2 |
| Target Gene | NHSL2 |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse (75%), Rat (29%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using PrEST antigen |
| Buffer Composition | 40% glycerol, PBS (pH 7.2), 0.02% sodium azide (preservative) |
| Safety Data | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



