Atlas Antibodies Anti-NHP2 Antibody

상품 한눈에 보기

Human NHP2 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 WB에서 독립 검증 완료. Human과 Mouse에 반응하며, PrEST 항원을 이용해 친화 정제됨. 다양한 응용 실험에 최적화된 고품질 항체.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA050400-100 Anti-NHP2 Antibody, NHP2 ribonucleoprotein 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA050400-25 Anti-NHP2 Antibody, NHP2 ribonucleoprotein 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: NHP2 ribonucleoprotein

IHC (Immunohistochemistry): Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
WB (Western Blot): Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.

Polyclonal antibody against Human NHP2.

FLJ20479, NOLA2

항목	내용
Target Protein	NHP2 ribonucleoprotein
Target Gene	NHP2
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	LAGDTLPIEVYCHLPVMCEDRNLPYVYIPSKTDLGAAAGSKRPTCVIMVKPHEEYQEAYDECLEEVQSLP
Verified Species Reactivity	Human, Mouse
Interspecies Identity	Rat ENSRNOG00000049622 (93%), Mouse ENSMUSG00000001056 (91%)

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand