
Atlas Antibodies Anti-NHEJ1 Antibody
상품 한눈에 보기
인간 NHEJ1 단백질을 인식하는 폴리클로날 항체로 비상동말단결합(NHEJ) 인자의 연구용으로 적합함. Rabbit에서 생산된 IgG 형식이며, PrEST 항원을 이용해 친화 정제됨. 인간에 반응하며 Rat, Mouse와 유사성 보유. PBS/glycerol 버퍼에 sodium azide 보존제 포함.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-NHEJ1 Antibody
Target: nonhomologous end-joining factor 1 (NHEJ1)
Supplier: Atlas Antibodies
Recommended Applications
면역세포화학(ICC)
Product Description
Polyclonal antibody against human NHEJ1.
Alternative Gene Names
- Cernunnos
- FLJ12610
- XLF
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | nonhomologous end-joining factor 1 |
| Target Gene | NHEJ1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Information | Rat ENSRNOG00000018162 (67%), Mouse ENSMUSG00000026162 (57%) |
Antigen Sequence:
FLEQFMIEKLPEACSIGDGKPFVMNLQDLYMAVTTQEVQVGQKHQGAGDPHTSNSASLQGIDSQCVNQPEQLVSSA
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-NHLRC3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NHLH2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NHEJ1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NGLY1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NGRN Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.