Atlas Antibodies Anti-NGLY1 Antibody

상품 한눈에 보기

Human NGLY1 단백질을 표적으로 하는 토끼 폴리클로날 항체로, IgG 아이소타입이며 Affinity purification 방식으로 정제됨. IHC 등 다양한 응용에 적합하며, 재조합 PrEST 항원 서열 기반으로 제작됨. Human에 대해 검증된 반응성을 가짐.

카탈로그번호: HPA036825-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA036825-100 Anti-NGLY1 Antibody, N-glycanase 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA036825-25 Anti-NGLY1 Antibody, N-glycanase 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-NGLY1 Antibody

Anti-NGLY1 Antibody

Target Information

Target Protein: N-glycanase 1
Target Gene: NGLY1
Alternative Gene Names: FLJ11005, PNG1

Recommended Applications

면역조직화학(IHC)

Product Description

Polyclonal Antibody against Human NGLY1

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

ISDEDFLLLELLHWFKEEFFHWVNNVLCSKCGGQTRSRDRSLLPSDDELKWGAKEVEDHYCDACQFSNRFPRYNNPEKLLETRCGR

Verified Species Reactivity

Human

Interspecies Information

Species	Gene ID	Sequence Identity
Rat	ENSRNOG00000006143	87%
Mouse	ENSMUSG00000021785	87%

Antibody Specifications

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
MSDS	Material Safety Data Sheet