CacheBy
Atlas Antibodies Anti-NFS1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NFS1 Antibody

상품 한눈에 보기

Human NFS1 단백질을 인식하는 rabbit polyclonal 항체로, IHC 및 ICC 응용에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공. Human에서 검증되었으며, Mouse 및 Rat과 95% 서열 동일성 보유.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA054755-100 Anti-NFS1 Antibody, NFS1 cysteine desulfurase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA054755-25 Anti-NFS1 Antibody, NFS1 cysteine desulfurase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NFS1 Antibody

Anti-NFS1 Antibody

NFS1 cysteine desulfurase


  • IHC (Independent antibody validation): 단백질 발현을 서로 다른 epitope을 타깃하는 독립 항체 간 비교를 통해 검증
  • ICC (Immunocytochemistry)

Product Description

Polyclonal Antibody against Human NFS1


Alternative Gene Names

IscS, NifS

Open Datasheet


Target Information

항목 내용
Target Protein NFS1 cysteine desulfurase
Target Gene NFS1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence GVGAIYIRRRPRVRVEALQSGGGQERGMRSGTVPTPLVVGLGAACEVAQQEMEYDHKRISKLSERLIQNIMKSLPDVVMNGDPKHHYPGCINLSF
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000027618 (95%), Rat ENSRNOG00000045686 (95%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 최적의 농도와 조건은 사용자가 실험에 맞게 결정해야 합니다.

제품 이미지

Enhanced Validation
IHC Independent Validation
Independent Validation Tooltip
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.