Atlas Antibodies Anti-NFS1 Antibody

상품 한눈에 보기

Human NFS1 단백질을 인식하는 rabbit polyclonal 항체로, IHC 및 ICC 응용에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공. Human에서 검증되었으며, Mouse 및 Rat과 95% 서열 동일성 보유.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA054755-100 Anti-NFS1 Antibody, NFS1 cysteine desulfurase 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA054755-25 Anti-NFS1 Antibody, NFS1 cysteine desulfurase 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

NFS1 cysteine desulfurase

IHC (Independent antibody validation): 단백질 발현을 서로 다른 epitope을 타깃하는 독립 항체 간 비교를 통해 검증
ICC (Immunocytochemistry)

Polyclonal Antibody against Human NFS1

IscS, NifS

항목	내용
Target Protein	NFS1 cysteine desulfurase
Target Gene	NFS1
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	GVGAIYIRRRPRVRVEALQSGGGQERGMRSGTVPTPLVVGLGAACEVAQQEMEYDHKRISKLSERLIQNIMKSLPDVVMNGDPKHHYPGCINLSF
Verified Species Reactivity	Human
Interspecies Identity	Mouse ENSMUSG00000027618 (95%), Rat ENSRNOG00000045686 (95%)

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand