CacheBy
Atlas Antibodies Anti-NFS1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NFS1 Antibody

상품 한눈에 보기

Human NFS1 cysteine desulfurase를 인식하는 rabbit polyclonal antibody로, IHC 및 ICC 검증에 적합. Affinity purification으로 높은 특이성과 재현성 확보. Human에 반응하며 Mouse, Rat과 95% 항원 서열 동일성 보유.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA051801-100 Anti-NFS1 Antibody, NFS1 cysteine desulfurase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA051801-25 Anti-NFS1 Antibody, NFS1 cysteine desulfurase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NFS1 Antibody

Anti-NFS1 Antibody

개요

Polyclonal antibody against Human NFS1 cysteine desulfurase.
Validated for IHC and ICC applications.

독립 검증 (Independent Validation)

단백질 발현을 검증하기 위해 서로 다른 epitope을 인식하는 독립적인 항체를 비교하여 IHC에서 단백질 발현을 확인함.

제품 설명

  • 형태: Polyclonal Antibody
  • 타깃 단백질: NFS1 cysteine desulfurase
  • 타깃 유전자: NFS1
  • 대체 유전자명: IscS, NifS
  • 항원: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

항원 서열

GVGAIYIRRRPRVRVEALQSGGGQERGMRSGTVPTPLVVGLGAACEVAQQEMEYDHKRISKLSERLIQNIMKSLPDVVMNGDPKHHYPGCINLSF

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000027618 95%
Rat ENSRNOG00000045686 95%

항체 특성

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet (MSDS)

사용 시 주의사항

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용 분야에 맞는 최적의 농도와 조건은 사용자가 직접 결정해야 합니다.

Open Datasheet

제품 이미지

Enhanced Validation
IHC Independent
Independent Validation
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.