Atlas Antibodies Anti-NFS1 Antibody

상품 한눈에 보기

Human NFS1 cysteine desulfurase를 인식하는 rabbit polyclonal antibody로, IHC 및 ICC 검증에 적합. Affinity purification으로 높은 특이성과 재현성 확보. Human에 반응하며 Mouse, Rat과 95% 항원 서열 동일성 보유.

카탈로그번호: HPA051801-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA051801-100 Anti-NFS1 Antibody, NFS1 cysteine desulfurase 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA051801-25 Anti-NFS1 Antibody, NFS1 cysteine desulfurase 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-NFS1 Antibody

Anti-NFS1 Antibody

개요

Polyclonal antibody against Human NFS1 cysteine desulfurase.
Validated for IHC and ICC applications.

독립 검증 (Independent Validation)

단백질 발현을 검증하기 위해 서로 다른 epitope을 인식하는 독립적인 항체를 비교하여 IHC에서 단백질 발현을 확인함.

제품 설명

형태: Polyclonal Antibody
타깃 단백질: NFS1 cysteine desulfurase
타깃 유전자: NFS1
대체 유전자명: IscS, NifS
항원: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

항원 서열

GVGAIYIRRRPRVRVEALQSGGGQERGMRSGTVPTPLVVGLGAACEVAQQEMEYDHKRISKLSERLIQNIMKSLPDVVMNGDPKHHYPGCINLSF

Verified Species Reactivity

Human

Interspecies Information

Species	Gene ID	Sequence Identity
Mouse	ENSMUSG00000027618	95%
Rat	ENSRNOG00000045686	95%

항체 특성

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand