Atlas Antibodies Anti-NELFE Antibody
상품 한눈에 보기
Human NELFE 단백질을 타깃으로 하는 Rabbit Polyclonal 항체. IHC 및 WB에서 검증된 신뢰성 높은 항체로, 독립적 및 정합적(orthogonal) 검증 완료. Affinity purification 방식으로 높은 특이성과 재현성을 보장.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-NELFE Antibody
Target: Negative elongation factor complex member E (NELFE)
Type: Polyclonal antibody (Rabbit IgG)
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Orthogonal validation): Protein expression validated by comparison to RNA-seq data across tissues of high and low expression.
- WB (Independent validation): Protein expression confirmed using independent antibodies targeting different epitopes of the same protein.
Product Description
Polyclonal antibody against human NELFE, validated for IHC and WB applications.
Alternative Gene Names
D6S45, NELF-E, RD, RDBP, RDP
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Negative elongation factor complex member E |
| Target Gene | NELFE |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | LLALKKQSSSSTTSQGGVKRSLSEQPVMDTATATEQAKQLVKSGAISAIKAETKNSGFKRSRTLEGKLKDPEKGPVPTFQPFQRSISADDDLQESSRRPQRKSLYESFVSSSDRLRELGPDG |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000000420 (94%), Mouse ENSMUSG00000024369 (93%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (MSDS) |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
- Open Datasheet (PDF)
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Atlas Antibodies
Atlas Antibodies Anti-NELFCD Antibody
528,000원
Atlas Antibodies
Atlas Antibodies Anti-NELFB Antibody
528,000원
Atlas Antibodies
Atlas Antibodies Anti-NELFE Antibody
528,000원
Atlas Antibodies
Atlas Antibodies Anti-NELFE Antibody
528,000원
Atlas Antibodies
Atlas Antibodies Anti-NELFCD Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.