
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-NELFCD Antibody
상품 한눈에 보기
Human NELFCD 단백질을 인식하는 토끼 유래 폴리클로날 항체. WB 및 ICC에 적합하며, PrEST 항원을 이용해 친화 정제됨. 높은 종간 반응성(인간, 마우스, 랫트) 보유. 안정한 PBS/glycerol buffer에 보존.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA050641-100 Anti-NELFCD Antibody, negative elongation factor complex member C/D 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA050641-25 Anti-NELFCD Antibody, negative elongation factor complex member C/D 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-NELFCD Antibody
Anti-NELFCD Antibody
Target: Negative elongation factor complex member C/D
Supplier: Atlas Antibodies
Recommended Applications
- Western Blot (WB)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human NELFCD.
Alternative Gene Names
HSPC130, NELF-C, NELF-D, TH1, TH1L
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Negative elongation factor complex member C/D |
| Target Gene | NELFCD |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Antigen Sequence Detail | ETVENHLKSLLIKHFDPRKADSIFTEEGETPAWLEQMIAHTTWRDLFYKLAEAHPDCLMLNFTVKLISDAGYQGEITSVS |
Verified Species Reactivity
Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Mouse ENSMUSG00000016253 (100%)
- Rat ENSRNOG00000047874 (99%)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



