CacheBy
Atlas Antibodies Anti-NEIL3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NEIL3 Antibody

상품 한눈에 보기

인간 NEIL3 단백질을 인식하는 폴리클로날 항체로, DNA 글라이코실레이스 연구에 적합합니다. 토끼 유래 IgG 항체이며, PrEST 항원으로 친화 정제되었습니다. 인간에 대해 검증되었으며, 다양한 응용에 사용할 수 있습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA065761-100 Anti-NEIL3 Antibody, nei-like DNA glycosylase 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA065761-25 Anti-NEIL3 Antibody, nei-like DNA glycosylase 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NEIL3 Antibody

Anti-NEIL3 Antibody

Target: nei-like DNA glycosylase 3 (NEIL3)
Type: Polyclonal Antibody against Human NEIL3


  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody raised in rabbit against human NEIL3 protein.


Alternative Gene Names

FLJ10858, FPG2, hFPG2, hNEI3, ZGRF3

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein nei-like DNA glycosylase 3
Target Gene NEIL3
Verified Species Reactivity Human
Interspecies Homology Rat ENSRNOG00000011688 (84%), Mouse ENSMUSG00000039396 (81%)

Antigen Information

항목 내용
Antigen Type Recombinant Protein Epitope Signature Tag (PrEST)
Antigen Sequence EALFDSGLHPAVKVCQLTDEQIHHLMKMIRDFSILFYRCRKAGLALSKHYKVYKRPNCGQCHCRITVC

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2)
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.