Atlas Antibodies Anti-NEIL3 Antibody
상품 한눈에 보기
인간 NEIL3 단백질을 인식하는 폴리클로날 항체로, DNA 글라이코실레이스 연구에 적합합니다. 토끼 유래 IgG 항체이며, PrEST 항원으로 친화 정제되었습니다. 인간에 대해 검증되었으며, 다양한 응용에 사용할 수 있습니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-NEIL3 Antibody
Target: nei-like DNA glycosylase 3 (NEIL3)
Type: Polyclonal Antibody against Human NEIL3
Recommended Applications
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody raised in rabbit against human NEIL3 protein.
Alternative Gene Names
FLJ10858, FPG2, hFPG2, hNEI3, ZGRF3
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | nei-like DNA glycosylase 3 |
| Target Gene | NEIL3 |
| Verified Species Reactivity | Human |
| Interspecies Homology | Rat ENSRNOG00000011688 (84%), Mouse ENSMUSG00000039396 (81%) |
Antigen Information
| 항목 | 내용 |
|---|---|
| Antigen Type | Recombinant Protein Epitope Signature Tag (PrEST) |
| Antigen Sequence | EALFDSGLHPAVKVCQLTDEQIHHLMKMIRDFSILFYRCRKAGLALSKHYKVYKRPNCGQCHCRITVC |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2)
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.