CacheBy
Atlas Antibodies Anti-NEIL2 Antibody
원본

Atlas Antibodies Anti-NEIL2 Antibody

상품 한눈에 보기

인간 NEIL2 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산되었습니다. Affinity purification 방식으로 정제되었으며, ICC 등 다양한 응용에 적합합니다. 40% glycerol 기반 buffer에 보존되어 안정성이 우수합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA073029-100 Anti-NEIL2 Antibody, nei like DNA glycosylase 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA073029-25 Anti-NEIL2 Antibody, nei like DNA glycosylase 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NEIL2 Antibody

Anti-NEIL2 Antibody

Target: nei like DNA glycosylase 2 (NEIL2)
Type: Polyclonal Antibody against Human NEIL2


  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody targeting human NEIL2 protein, produced in rabbit.


Alternative Gene Names

FLJ31644, MGC2832, MGC4505, NEH2

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein nei like DNA glycosylase 2
Target Gene NEIL2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000010696 (89%), Mouse ENSMUSG00000035121 (88%)

Antigen Sequence:

DPSPRLVLHFGGGGFLAFYNCQLSWSSSPVVTPTCDILSEKFHRGQALEALGQAQPVCYTLLDQRYFSGLGN

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

구성 설명
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
Safety Data Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Recommended Application: ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.