CacheBy
Atlas Antibodies Anti-NEDD8 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NEDD8 Antibody

상품 한눈에 보기

Human NEDD8 단백질을 인식하는 Rabbit Polyclonal 항체로, 신경전구세포 발현 및 발달 관련 단백질 연구에 적합. PrEST 항원을 이용해 친화정제됨. Human, Mouse, Rat에서 반응 확인. ICC 등 다양한 응용에 사용 가능.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA060254-100 Anti-NEDD8 Antibody, neural precursor cell expressed, developmentally down-regulated 8 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA060254-25 Anti-NEDD8 Antibody, neural precursor cell expressed, developmentally down-regulated 8 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NEDD8 Antibody

Anti-NEDD8 Antibody

Full Name: neural precursor cell expressed, developmentally down-regulated 8
Supplier: Atlas Antibodies

  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against Human NEDD8 protein, suitable for research applications involving ubiquitin-like protein modification pathways.

Alternative Gene Names

  • Nedd-8

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein neural precursor cell expressed, developmentally down-regulated 8
Target Gene NEDD8
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence TLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVL
Verified Species Reactivity Human
Interspecies Identity Mouse (ENSMUSG00000010376, 100%), Rat (ENSRNOG00000019895, 100%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet (MSDS)

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용 분야에 따라 최적의 농도와 조건을 사용자가 직접 설정해야 합니다.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.