
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-NEDD8 Antibody
상품 한눈에 보기
Human NEDD8 단백질을 인식하는 Rabbit Polyclonal 항체로, 신경전구세포 발현 및 발달 관련 단백질 연구에 적합. PrEST 항원을 이용해 친화정제됨. Human, Mouse, Rat에서 반응 확인. ICC 등 다양한 응용에 사용 가능.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA060254-100 Anti-NEDD8 Antibody, neural precursor cell expressed, developmentally down-regulated 8 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA060254-25 Anti-NEDD8 Antibody, neural precursor cell expressed, developmentally down-regulated 8 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-NEDD8 Antibody
Anti-NEDD8 Antibody
Full Name: neural precursor cell expressed, developmentally down-regulated 8
Supplier: Atlas Antibodies
Recommended Applications
- ICC (Immunocytochemistry)
Product Description
Polyclonal antibody against Human NEDD8 protein, suitable for research applications involving ubiquitin-like protein modification pathways.
Alternative Gene Names
- Nedd-8
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | neural precursor cell expressed, developmentally down-regulated 8 |
| Target Gene | NEDD8 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | TLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVL |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse (ENSMUSG00000010376, 100%), Rat (ENSRNOG00000019895, 100%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Material Safety Data Sheet (MSDS)
Notes
- 사용 전 부드럽게 혼합하십시오.
- 각 응용 분야에 따라 최적의 농도와 조건을 사용자가 직접 설정해야 합니다.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



