
Atlas Antibodies Anti-NEDD8 Antibody
상품 한눈에 보기
Human NEDD8 단백질을 인식하는 Rabbit Polyclonal 항체로, 신경전구세포 발현 및 발달 관련 단백질 연구에 적합. PrEST 항원을 이용해 친화정제됨. Human, Mouse, Rat에서 반응 확인. ICC 등 다양한 응용에 사용 가능.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-NEDD8 Antibody
Full Name: neural precursor cell expressed, developmentally down-regulated 8
Supplier: Atlas Antibodies
Recommended Applications
- ICC (Immunocytochemistry)
Product Description
Polyclonal antibody against Human NEDD8 protein, suitable for research applications involving ubiquitin-like protein modification pathways.
Alternative Gene Names
- Nedd-8
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | neural precursor cell expressed, developmentally down-regulated 8 |
| Target Gene | NEDD8 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | TLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVL |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse (ENSMUSG00000010376, 100%), Rat (ENSRNOG00000019895, 100%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Material Safety Data Sheet (MSDS)
Notes
- 사용 전 부드럽게 혼합하십시오.
- 각 응용 분야에 따라 최적의 농도와 조건을 사용자가 직접 설정해야 합니다.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-NEDD1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NEDD8 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NEDD8 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NECTIN2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NEDD4L Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.