Atlas Antibodies Anti-NECTIN2 Antibody

상품 한눈에 보기

Human NECTIN2 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC Orthogonal 검증 완료. CD112/HVEB 등 대체 유전자명으로도 알려짐. Affinity purified 방식으로 제조되어 높은 특이성과 재현성을 제공. Human 시료 분석에 적합.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA012759-100 Anti-NECTIN2 Antibody, nectin cell adhesion molecule 2 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA012759-25 Anti-NECTIN2 Antibody, nectin cell adhesion molecule 2 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-NECTIN2 Antibody

Anti-NECTIN2 Antibody

Target: nectin cell adhesion molecule 2

Recommended Applications

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal Antibody against Human NECTIN2

Alternative Gene Names

CD112, HVEB, PRR2, PVRL2, PVRR2

Open Datasheet

Target Information

항목	내용
Target Protein	nectin cell adhesion molecule 2
Target Gene	NECTIN2
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	VRVQVLPEVRGQLGGTVELPCHLLPPVPGLYISLVTWQRPDAPANHQNVAAFHPKMGPSFPSPKPGSERLSFVSAKQSTGQDTEAELQDATLALHGLTVEDEGNYTCEFATFPKGSVRGMTWLR