
Atlas Antibodies Anti-NDUFV3 Antibody
상품 한눈에 보기
인간 NDUFV3 단백질을 인식하는 폴리클로날 항체로, IHC 등 다양한 응용에 적합합니다. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공합니다. 토끼 유래 IgG 형식이며, 40% 글리세롤 PBS 버퍼에 보존제를 포함합니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-NDUFV3 Antibody
NADH dehydrogenase (ubiquinone) flavoprotein 3, 10kDa
Recommended Applications
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal antibody against Human NDUFV3
Alternative Gene Names
- CI-10k
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | NADH dehydrogenase (ubiquinone) flavoprotein 3, 10kDa |
| Target Gene | NDUFV3 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000024038 (49%) Rat ENSRNOG00000001182 (48%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Safety Data Sheet | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Antigen Sequence
PPLPRKETSGTQGIEGHLKGGQAIVEDQIPPSNLETVPVENNHGFHEKTAALKLEAEGEAMEDAAAPGDDRGGTQEPAPVPAEPFDNTTYKNLQHHDYSTYTFLDLNLELSKFRMP제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-NECAB1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NDUFV2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NDUFV3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NDUFV3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NDUFV3 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.