
Atlas Antibodies Anti-NDUFV3 Antibody
상품 한눈에 보기
Human NDUFV3 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 등 단백질 발현 검증에 사용 가능. PrEST 항원을 이용해 친화 정제되었으며, 40% 글리세롤 PBS 완충액에 보존됨. 인간에 대해 검증되었으며 마우스·랫과 교차 반응 가능성 있음.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-NDUFV3 Antibody
Target: NADH dehydrogenase (ubiquinone) flavoprotein 3, 10kDa
Supplier: Atlas Antibodies
Recommended Applications
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal antibody against human NDUFV3.
Alternative Gene Names
- CI-10k
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | NADH dehydrogenase (ubiquinone) flavoprotein 3, 10kDa |
| Target Gene | NDUFV3 |
| Antigen Sequence Type | Recombinant Protein Epitope Signature Tag (PrEST) |
| Antigen Sequence | PPLPRKETSGTQGIEGHLKGGQAIVEDQIPPSNLETVPVENNHGFHEKTAALKLEAEGEAMEDAAAPGDDRGGTQEPAPVPAEPFDNTTYKNLQHHDYSTYTFLDLNLELSKFRMP |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000024038 (49%), Rat ENSRNOG00000001182 (48%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
- 40% glycerol and PBS (pH 7.2)
- 0.02% sodium azide added as preservative
- Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
- Open Datasheet
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-NDUFV2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NDUFV3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NDUFV3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NDUFV3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NEB Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.