
Atlas Antibodies Anti-NDRG1 Antibody
인간 NDRG1 단백질을 표적으로 하는 폴리클로날 항체로, IHC 및 WB에서 RNA-seq 데이터 기반 정교한 Orthogonal 검증 수행. Rabbit 호스트, IgG 아이소타입, PrEST 항원으로 친화 정제. 인간 및 랫트 반응성 확인, 연구용으로 적합.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-NDRG1 Antibody
Target: N-myc downstream regulated 1 (NDRG1)
Recommended Applications
IHC (Immunohistochemistry)
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.WB (Western Blot)
Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.ICC (Immunocytochemistry)
Product Description
Polyclonal Antibody against Human NDRG1
Alternative Gene Names
CAP43, DRG1, NDR1, RTP, TDD5
Specifications
| 항목 | 내용 |
|---|---|
| Target Protein | N-myc downstream regulated 1 |
| Target Gene | NDRG1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human, Rat |
| Interspecies Information | Rat ENSRNOG00000007393 (94%), Mouse ENSMUSG00000005125 (93%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Antigen Sequence
INVNPCAEGWMDWAASKISGWTQALPDMVVSHLFGKEEMQSNVEVVHTYRQHIVNDMNPGNLHLFINAYNSRRDLEIERPMPGTHTVTLQCPALLVVGDSSPAVDAVVECNSKLDPTKTTLL제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-NDRG3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NDRG2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NDRG1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NDOR1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NDFIP2 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|