CacheBy
Atlas Antibodies Anti-NDOR1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NDOR1 Antibody

상품 한눈에 보기

Human NDOR1 단백질을 인식하는 토끼 폴리클로날 항체. IHC, WB, ICC에 적합하며 사람, 마우스, 랫트에 반응. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성 제공.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA024504-100 Anti-NDOR1 Antibody, NADPH dependent diflavin oxidoreductase 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA024504-25 Anti-NDOR1 Antibody, NADPH dependent diflavin oxidoreductase 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NDOR1 Antibody

Anti-NDOR1 Antibody

NADPH dependent diflavin oxidoreductase 1

  • IHC (Immunohistochemistry)
  • WB (Western Blot)
  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against human NDOR1.

Alternative Gene Names

bA350O14.9, NR1

Open Datasheet

Target Information

항목 내용
Target Protein NADPH dependent diflavin oxidoreductase 1
Target Gene NDOR1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence QPCSMRHLVSHYLDIASVPRRSFFELLACLSLHELEREKLLEFSSAQGQEELFEYCNRPRRTILEVLCDFPHTAAAIPPDYLLD
Verified Species Reactivity Human, Mouse, Rat
Interspecies Information Rat ENSRNOG00000010616 (88%), Mouse ENSMUSG00000006471 (86%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

IHC
WB
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.