
Atlas Antibodies Anti-NCOA2 Antibody
상품 한눈에 보기
인간 NCOA2 단백질을 표적으로 하는 폴리클로날 항체로 핵 수용체 코액티베이터 2 연구에 적합. 토끼 유래 IgG 항체이며, 높은 종간 서열 일치율을 보임. Affinity purification 방식으로 정제되어 신뢰성 높은 결과 제공.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-NCOA2 Antibody
Target: Nuclear receptor coactivator 2 (NCOA2)
Recommended Applications
ICC (Immunocytochemistry)
Product Description
Polyclonal antibody against Human NCOA2.
Alternative Gene Names
bHLHe75, GRIP1, KAT13C, NCoA-2, TIF2
Target Information
- Target Protein: Nuclear receptor coactivator 2
- Target Gene: NCOA2
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:PKLERLDSKTDPASNTKLIAMKTEKEEMSFEPGDQPGSELDNLEEILDDLQNSQLPQLFPDTRPGAPAGSV
Verified Species Reactivity
Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000005886 | 94% |
| Rat | ENSRNOG00000007975 | 94% |
Antibody Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.
