CacheBy
Atlas Antibodies Anti-NCOA2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NCOA2 Antibody

상품 한눈에 보기

인간 NCOA2 단백질을 표적으로 하는 폴리클로날 항체로 핵 수용체 코액티베이터 2 연구에 적합. 토끼 유래 IgG 항체이며, 높은 종간 서열 일치율을 보임. Affinity purification 방식으로 정제되어 신뢰성 높은 결과 제공.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA060243-100 Anti-NCOA2 Antibody, nuclear receptor coactivator 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA060243-25 Anti-NCOA2 Antibody, nuclear receptor coactivator 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NCOA2 Antibody

Anti-NCOA2 Antibody

Target: Nuclear receptor coactivator 2 (NCOA2)

ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against Human NCOA2.

Alternative Gene Names

bHLHe75, GRIP1, KAT13C, NCoA-2, TIF2

Open Datasheet

Target Information

  • Target Protein: Nuclear receptor coactivator 2
  • Target Gene: NCOA2

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
PKLERLDSKTDPASNTKLIAMKTEKEEMSFEPGDQPGSELDNLEEILDDLQNSQLPQLFPDTRPGAPAGSV

Verified Species Reactivity

Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000005886 94%
Rat ENSRNOG00000007975 94%

Antibody Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지

Recommended Applications

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.