CacheBy
Atlas Antibodies Anti-NCMAP Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NCMAP Antibody

상품 한눈에 보기

Human NCMAP 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산됨. IHC 등 다양한 응용에 적합. PrEST 항원을 이용해 친화 정제되었으며, 높은 특이성과 재현성을 제공. Human에 대해 검증 완료.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA013656-100 Anti-NCMAP Antibody, noncompact myelin associated protein 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA013656-25 Anti-NCMAP Antibody, noncompact myelin associated protein 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NCMAP Antibody

Anti-NCMAP Antibody

Target: noncompact myelin associated protein (NCMAP)
Supplier: Atlas Antibodies


면역조직화학 (IHC) 등 다양한 연구용 응용에 적합


Product Description

Polyclonal antibody against human NCMAP.


Alternative Gene Names

C1orf130, FLJ42528, MP11

Open Datasheet


Target Information

  • Target Protein: noncompact myelin associated protein
  • Target Gene: NCMAP
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
    YNRKMRTRRELEPKGPKPTAPSAVGPNSNGSQHPATVTFSPVDVQVE

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse ENSMUSG00000043924 (72%)
  • Rat ENSRNOG00000048139 (72%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용에 대한 최적 농도 및 조건은 사용자가 직접 결정해야 합니다.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.