
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-NCMAP Antibody
상품 한눈에 보기
Human NCMAP 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산됨. IHC 등 다양한 응용에 적합. PrEST 항원을 이용해 친화 정제되었으며, 높은 특이성과 재현성을 제공. Human에 대해 검증 완료.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA013656-100 Anti-NCMAP Antibody, noncompact myelin associated protein 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA013656-25 Anti-NCMAP Antibody, noncompact myelin associated protein 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-NCMAP Antibody
Anti-NCMAP Antibody
Target: noncompact myelin associated protein (NCMAP)
Supplier: Atlas Antibodies
Recommended Applications
면역조직화학 (IHC) 등 다양한 연구용 응용에 적합
Product Description
Polyclonal antibody against human NCMAP.
Alternative Gene Names
C1orf130, FLJ42528, MP11
Target Information
- Target Protein: noncompact myelin associated protein
- Target Gene: NCMAP
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
YNRKMRTRRELEPKGPKPTAPSAVGPNSNGSQHPATVTFSPVDVQVE
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Mouse ENSMUSG00000043924 (72%)
- Rat ENSRNOG00000048139 (72%)
Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- 사용 전 부드럽게 혼합하십시오.
- 각 응용에 대한 최적 농도 및 조건은 사용자가 직접 결정해야 합니다.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



