
Atlas Antibodies Anti-NCBP1 Antibody
상품 한눈에 보기
Human NCBP1 단백질을 표적으로 하는 고품질 폴리클로날 토끼 항체입니다. IHC, WB, ICC 등 다양한 응용에 적합하며, Orthogonal 및 Independent validation을 통해 단백질 발현이 검증되었습니다. Affinity purification으로 높은 특이성과 재현성을 제공합니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-NCBP1 Antibody
Target: nuclear cap binding protein subunit 1 (80 kDa)
Product Type: Polyclonal Antibody against Human NCBP1
Recommended Applications
- IHC (Orthogonal validation): 단백질 발현을 RNA-seq 데이터와 비교하여 고·저 발현 조직에서 검증
- WB (Independent validation): 서로 다른 에피토프를 인식하는 독립 항체 간 비교를 통한 단백질 발현 검증
- ICC: 세포 수준에서 단백질 발현 분석에 사용
Alternative Gene Names
CBP80, NCBP, Sto1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | nuclear cap binding protein subunit 1, 80kDa |
| Target Gene | NCBP1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Information | Mouse ENSMUSG00000028330 (98%), Rat ENSRNOG00000023605 (98%) |
Antigen Sequence:
FVSVTQEEDVPQVRRDWYVYAFLSSLPWVGKELYEKKDAEMDRIFANTESYLKRRQKTHVPMLQVWTADKPHPQEEYLDCLWAQIQKLKKDRWQERHILRPYLAFDSILCEALQHNLPPFTPPPH
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| MSDS | Material Safety Data Sheet |
Notes
- 사용 전 부드럽게 혼합하십시오.
- 각 응용 분야별 최적 농도 및 조건은 사용자가 직접 결정해야 합니다.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-NCAPG2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NCAPH2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NCBP1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NCAM2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NCAPG Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.