CacheBy
Atlas Antibodies Anti-NCAPH2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NCAPH2 Antibody

상품 한눈에 보기

인간 NCAPH2 단백질을 인식하는 토끼 폴리클로날 항체. WB 및 ICC에 적합하며 siRNA 노크다운으로 유전적 검증 완료. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공. 글리세롤 기반 완충액에 보존제 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA069056-100 Anti-NCAPH2 Antibody, non-SMC condensin II complex, subunit H2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA069056-25 Anti-NCAPH2 Antibody, non-SMC condensin II complex, subunit H2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NCAPH2 Antibody

Anti-NCAPH2 Antibody

non-SMC condensin II complex, subunit H2

  • Western Blot (WB)
  • Immunocytochemistry (ICC)
  • Genetic validation in WB by siRNA knockdown

Product Description

Polyclonal antibody against Human NCAPH2

Alternative Gene Names

384D8-2, CAP-H2, hCAP-H2

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein non-SMC condensin II complex, subunit H2
Target Gene NCAPH2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence AAKLQDFHQWYLAAYADHADSRRLRRKGPSFADMEVLYWTHVKEQLETLRKLQRREVAEQWLRPAEEDHLEDSLEDLGAADDFLEPEEYMEPEG
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000008690 (70%), Rat ENSRNOG00000009598 (69%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Buffer Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지

Enhanced Validation
WB Genetic Validation
Genetic Validation Tooltip
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.