CacheBy
Thermo Fisher Scientific SAFB Polyclonal Antibody
원본

Thermo Fisher Scientific SAFB Polyclonal Antibody

상품 한눈에 보기

인간 SAFB 단백질을 인식하는 Rabbit Polyclonal 항체로, Western Blot에 적합합니다. 합성 펩타이드 면역원으로 제작되었으며, 항원 친화 크로마토그래피로 정제되었습니다. 동결건조 형태로 제공되며, 재구성 시 500 µg/mL 농도로 사용 가능합니다.

판매단위
pk
카탈로그 보기

카탈로그

1개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 04. 오후 06:42
Thermo Fisher Scientific PA579952 SAFB Polyclonal Antibody 100 ug pk판매 단위 pk ·
재고 확인 필요
568,000원VAT 포함 624,800원

Thermo Fisher Scientific · Thermo Fisher Scientific SAFB Polyclonal Antibody

Applications

Western Blot (WB)

  • Tested Dilution: 0.1–0.5 µg/mL

Product Specifications

항목 내용
Species Reactivity Human
Host/Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human SAFB (715–754 aa: DLDRRDDAYWPEAKRAALDERYHSDFNRQDRFHDFDHRDR)
Conjugate Unconjugated
Form Lyophilized
Concentration 500 µg/mL
Purification Antigen affinity chromatography
Storage buffer PBS with 5 mg BSA
Contains 0.05 mg sodium azide
Storage conditions -20°C
Shipping conditions Ambient (domestic); Wet ice (international)
RRID AB_2747067

Product Specific Information

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

Target Information

This gene encodes a DNA-binding protein with high specificity for scaffold or matrix attachment region DNA elements (S/MAR DNA). It is thought to attach chromatin loops to the nuclear matrix, though evidence varies on whether it is part of chromatin or the nuclear matrix. Scaffold attachment factors are a subset of nuclear matrix proteins that bind specifically to S/MAR. The encoded protein may act as a molecular base for assembling a transcriptosome complex near actively transcribed genes. It regulates heat shock protein 27 transcription, can act as an estrogen receptor co-repressor, and is a candidate gene for breast tumorigenesis. Multiple transcript variants encoding different isoforms have been identified.


For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

Thermo Fisher Scientific 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.