
Thermo Fisher Scientific SAFB Polyclonal Antibody
인간 SAFB 단백질을 인식하는 Rabbit Polyclonal 항체로, Western Blot에 적합합니다. 합성 펩타이드 면역원으로 제작되었으며, 항원 친화 크로마토그래피로 정제되었습니다. 동결건조 형태로 제공되며, 재구성 시 500 µg/mL 농도로 사용 가능합니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications
Western Blot (WB)
- Tested Dilution: 0.1–0.5 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human |
| Host/Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human SAFB (715–754 aa: DLDRRDDAYWPEAKRAALDERYHSDFNRQDRFHDFDHRDR) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage conditions | -20°C |
| Shipping conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2747067 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
This gene encodes a DNA-binding protein with high specificity for scaffold or matrix attachment region DNA elements (S/MAR DNA). It is thought to attach chromatin loops to the nuclear matrix, though evidence varies on whether it is part of chromatin or the nuclear matrix. Scaffold attachment factors are a subset of nuclear matrix proteins that bind specifically to S/MAR. The encoded protein may act as a molecular base for assembling a transcriptosome complex near actively transcribed genes. It regulates heat shock protein 27 transcription, can act as an estrogen receptor co-repressor, and is a candidate gene for breast tumorigenesis. Multiple transcript variants encoding different isoforms have been identified.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Thermo Fisher Scientific
Thermo Fisher Scientific Uteroglobin Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific SCRIB Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific SAFB Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific SATB1 Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific S-arrestin Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|