
Atlas Antibodies Anti-NAPG Antibody
상품 한눈에 보기
Human NAPG 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 WB에 적합. Orthogonal 및 Recombinant Expression 검증 완료. PrEST 항원으로 정제되었으며, 고순도 IgG 형태로 제공. PBS와 glycerol buffer에 보존.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-NAPG Antibody
N-ethylmaleimide-sensitive factor attachment protein, gamma
Recommended Applications
IHC Orthogonal Validation
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.WB Recombinant Expression Validation
Recombinant expression validation in WB using target protein overexpression.
Product Description
Polyclonal Antibody against Human NAPG
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | N-ethylmaleimide-sensitive factor attachment protein, gamma |
| Target Gene | NAPG |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | RGRRFDEAALSIQKEKNIYKEIENYPTCYKKTIAQVLVHLHRNDYVAAERCVRESYSIPGFNGSEDCAALEQLLEGYDQQDQDQVSDVCNSPLFKYMDNDYAKLGLSLVVPGGGIKKKSPATPQAKPDGVTATAA |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000024581 (96%), Rat ENSRNOG00000018914 (96%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-NAPEPLD Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NAPRT Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NAPG Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NAPRT Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NAPG Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.