
Atlas Antibodies Anti-NAPG Antibody
상품 한눈에 보기
Human NAPG 단백질을 인식하는 토끼 다클론 항체로, IHC 및 WB 검증 완료. 정제된 PrEST 항원을 사용한 친화 정제 방식. RNA-seq 기반 직교 검증 및 재조합 발현 검증 수행. 다양한 조직 연구 및 단백질 발현 분석에 적합.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-NAPG Antibody
N-ethylmaleimide-sensitive factor attachment protein, gamma
Recommended Applications
Orthogonal Validation (IHC)
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.Recombinant Expression Validation (WB)
Recombinant expression validation in WB using target protein overexpression.
Product Description
Polyclonal Antibody against Human NAPG
Open Datasheet
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | N-ethylmaleimide-sensitive factor attachment protein, gamma |
| Target Gene | NAPG |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | RGRRFDEAALSIQKEKNIYKEIENYPTCYKKTIAQVLVHLHRNDYVAAERCVRESYSIPGFNGSEDCAALEQLLEGYDQQDQDQVSDVCNSPLFKYMDNDYAKLGLSLVVPGGGIKKKSPATPQAKPDGVTATAA |
| Verified Species Reactivity | Human |
| Interspecies Information | Rat ENSRNOG00000018914 (96%), Mouse ENSMUSG00000024581 (96%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.
