Atlas Antibodies Anti-NAPG Antibody

상품 한눈에 보기

Human NAPG 단백질을 인식하는 토끼 다클론 항체로, IHC 및 WB 검증 완료. 정제된 PrEST 항원을 사용한 친화 정제 방식. RNA-seq 기반 직교 검증 및 재조합 발현 검증 수행. 다양한 조직 연구 및 단백질 발현 분석에 적합.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA008208-100 Anti-NAPG Antibody, N-ethylmaleimide-sensitive factor attachment protein, gamma 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA008208-25 Anti-NAPG Antibody, N-ethylmaleimide-sensitive factor attachment protein, gamma 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

N-ethylmaleimide-sensitive factor attachment protein, gamma

Orthogonal Validation (IHC)
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Recombinant Expression Validation (WB)
Recombinant expression validation in WB using target protein overexpression.

Polyclonal Antibody against Human NAPG
Open Datasheet

항목	내용
Target Protein	N-ethylmaleimide-sensitive factor attachment protein, gamma
Target Gene	NAPG
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	RGRRFDEAALSIQKEKNIYKEIENYPTCYKKTIAQVLVHLHRNDYVAAERCVRESYSIPGFNGSEDCAALEQLLEGYDQQDQDQVSDVCNSPLFKYMDNDYAKLGLSLVVPGGGIKKKSPATPQAKPDGVTATAA
Verified Species Reactivity	Human
Interspecies Information	Rat ENSRNOG00000018914 (96%), Mouse ENSMUSG00000024581 (96%)

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand