
Atlas Antibodies Anti-NAP1L1 Antibody
상품 한눈에 보기
Human NAP1L1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 사람, 생쥐, 랫드에서 반응성이 검증되었습니다. 40% 글리세롤 기반 PBS 버퍼에 보존되어 있습니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-NAP1L1 Antibody
Target: nucleosome assembly protein 1-like 1 (NAP1L1)
Type: Polyclonal Antibody against Human NAP1L1
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Product Description
Polyclonal antibody raised in rabbit against human NAP1L1.
Affinity purified using the PrEST antigen as affinity ligand.
Alternative Gene Names
MGC23410, MGC8688, NAP1, NAP1L, NRP
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | nucleosome assembly protein 1-like 1 |
| Target Gene | NAP1L1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | MADIDNKEQSELDQDLDDVEEVEEEETGEETKLKARQLTVQMMQNPQILAALQERLDGLVETPTGYIESLPRVVK |
| Verified Species Reactivity | Human, Mouse, Rat |
| Interspecies Identity | Rat ENSRNOG00000003890 (95%), Mouse ENSMUSG00000058799 (95%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using PrEST antigen |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-NAP1L5 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NAP1L2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NAP1L1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NANOS3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NANOS2 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.