CacheBy
Atlas Antibodies Anti-NAP1L1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NAP1L1 Antibody

상품 한눈에 보기

Human NAP1L1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 사람, 생쥐, 랫드에서 반응성이 검증되었습니다. 40% 글리세롤 기반 PBS 버퍼에 보존되어 있습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA028861-100 Anti-NAP1L1 Antibody, nucleosome assembly protein 1-like 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA028861-25 Anti-NAP1L1 Antibody, nucleosome assembly protein 1-like 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NAP1L1 Antibody

Anti-NAP1L1 Antibody

Target: nucleosome assembly protein 1-like 1 (NAP1L1)
Type: Polyclonal Antibody against Human NAP1L1


  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody raised in rabbit against human NAP1L1.
Affinity purified using the PrEST antigen as affinity ligand.


Alternative Gene Names

MGC23410, MGC8688, NAP1, NAP1L, NRP

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein nucleosome assembly protein 1-like 1
Target Gene NAP1L1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence MADIDNKEQSELDQDLDDVEEVEEEETGEETKLKARQLTVQMMQNPQILAALQERLDGLVETPTGYIESLPRVVK
Verified Species Reactivity Human, Mouse, Rat
Interspecies Identity Rat ENSRNOG00000003890 (95%), Mouse ENSMUSG00000058799 (95%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using PrEST antigen
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

IHC Application
WB Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.