CacheBy
Atlas Antibodies Anti-NANOS3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NANOS3 Antibody

상품 한눈에 보기

Human NANOS3 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 RNA-seq 데이터 비교를 통한 Orthogonal 검증 제공. Affinity purification으로 높은 특이성과 재현성 확보. 40% glycerol/PBS 버퍼에 보존제로 sodium azide 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA062989-100 Anti-NANOS3 Antibody, nanos homolog 3 (Drosophila) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA062989-25 Anti-NANOS3 Antibody, nanos homolog 3 (Drosophila) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NANOS3 Antibody

Anti-NANOS3 Antibody

nanos homolog 3 (Drosophila)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal Antibody against Human NANOS3

Alternative Gene Names

NANOS1L, NOS3

Open Datasheet

Target Information

항목 내용
Target Protein nanos homolog 3 (Drosophila)
Target Gene NANOS3
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000031593 (46%), Mouse ENSMUSG00000056155 (46%)

Antigen Sequence:
LAHLVRALSGKEGPETRLSPQPEPEPMLEPVSALEPMPAPESVPVPGPKDQKRSLESSPAPERLCSFCKHNG

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.