
Atlas Antibodies Anti-MYOM2 Antibody
상품 한눈에 보기
Human MYOM2 단백질을 타깃으로 하는 Rabbit Polyclonal 항체. IHC 및 ICC 응용에 적합하며 RNA-seq 기반 Orthogonal 검증 완료. PrEST 항원으로 친화 정제된 고품질 항체로, 다양한 조직에서 MYOM2 발현 연구에 활용 가능.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-MYOM2 Antibody
Target: myomesin 2 (MYOM2)
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Orthogonal Validation): Protein expression validated by comparison to RNA-seq data in tissues with high and low target expression.
- ICC: Suitable for immunocytochemistry applications.
Product Description
Polyclonal antibody against human MYOM2.
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | myomesin 2 |
| Target Gene | MYOM2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | STQASSQKSLSQRSSSQRASSQTSLGGTICRVCAKRVSTQEDEEQENRSRYQSLVAAYGEAKRQRFLSELAHLEEDVHLARSQARDKLDKYAIQQMMEDKLAWERHTFEERISRAPEILVRLRSHTVWERMSVKLCFTVQGF |
| Verified Species Reactivity | Human |
| Interspecies Information | Mouse ENSMUSG00000031461 (75%), Rat ENSRNOG00000011754 (71%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide as preservative. Material Safety Data Sheet |
| Notes | Gently mix before use. Optimal concentrations and conditions should be determined by the user. |
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-MYOM3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MYOM3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MYOM2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MYOM2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MYOM1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.