CacheBy
Atlas Antibodies Anti-MYOM3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-MYOM3 Antibody

상품 한눈에 보기

사람 MYOM3 단백질을 인식하는 폴리클로날 항체로, 면역조직화학 등 다양한 응용에 적합합니다. 토끼에서 생산된 IgG 형 항체이며, PrEST 항원으로 친화 정제되었습니다. 인간에 특이적으로 반응하며, 사용 전 부드럽게 혼합하는 것이 권장됩니다.

카탈로그번호
HPA028132-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA028132-100 Anti-MYOM3 Antibody, myomesin 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA028132-25 Anti-MYOM3 Antibody, myomesin 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MYOM3 Antibody

Anti-MYOM3 Antibody

Target Information

  • Target Protein: myomesin 3
  • Target Gene: MYOM3
  • Alternative Gene Names: FLJ35961

Product Description

Polyclonal antibody against human MYOM3.

Antigen Sequence (Recombinant Protein Epitope Signature Tag, PrEST):

ASLKVSCTYKEDEGLYMVRVPSPFGPREQSTYVLVRDAEAENPGAPGSPLNVRCLDVNRDCLILTWAPPSDTRGNPITAYTIERCQGESGEWI

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat (ENSRNOG00000032994): 74%
  • Mouse (ENSMUSG00000037139): 74%
  • Immunohistochemistry (IHC)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

Reference Documents

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.