CacheBy
Atlas Antibodies Anti-MYH14 Antibody
원본

Atlas Antibodies Anti-MYH14 Antibody

상품 한눈에 보기

Human MYH14 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산됨. Affinity purification 방식으로 정제되어 높은 특이성과 재현성을 제공. ICC 등 다양한 응용에 적합하며 Human에 반응성이 검증됨. 안정적인 PBS/glycerol buffer에 보존.

카탈로그번호
HPA062391-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA062391-100 Anti-MYH14 Antibody, myosin, heavy chain 14, non-muscle 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA062391-25 Anti-MYH14 Antibody, myosin, heavy chain 14, non-muscle 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MYH14 Antibody

Anti-MYH14 Antibody

Target: myosin, heavy chain 14, non-muscle
Supplier: Atlas Antibodies

Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human MYH14.

Alternative Gene Names

DFNA4, FLJ13881, KIAA2034, MHC16, MYH17

Open Datasheet (PDF)

Target Information

  • Target Protein: myosin, heavy chain 14, non-muscle
  • Target Gene: MYH14
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
    GAGEQLKADLLLEPCSHYRFLTNGPSSSPGQERELFQETLESLRVLGFSHEE

Verified Species Reactivity

Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000030739 94%
Rat ENSRNOG00000020014 92%

Antibody Properties

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using PrEST antigen
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.