
Atlas Antibodies Anti-MYH14 Antibody
상품 한눈에 보기
Human MYH14 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산됨. Affinity purification 방식으로 정제되어 높은 특이성과 재현성을 제공. ICC 등 다양한 응용에 적합하며 Human에 반응성이 검증됨. 안정적인 PBS/glycerol buffer에 보존.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-MYH14 Antibody
Target: myosin, heavy chain 14, non-muscle
Supplier: Atlas Antibodies
Recommended Applications
Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against Human MYH14.
Alternative Gene Names
DFNA4, FLJ13881, KIAA2034, MHC16, MYH17
Target Information
- Target Protein: myosin, heavy chain 14, non-muscle
- Target Gene: MYH14
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
GAGEQLKADLLLEPCSHYRFLTNGPSSSPGQERELFQETLESLRVLGFSHEE
Verified Species Reactivity
Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000030739 | 94% |
| Rat | ENSRNOG00000020014 | 92% |
Antibody Properties
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using PrEST antigen |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-MYH15 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MYH14 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MYH14 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MYH11 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MYH10 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.