
원본
Atlas Antibodies Anti-MYH14 Antibody
상품 한눈에 보기
Human MYH14 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산됨. Affinity purification 방식으로 정제되어 높은 특이성과 재현성을 제공. ICC 등 다양한 응용에 적합하며 Human에 반응성이 검증됨. 안정적인 PBS/glycerol buffer에 보존.
- 카탈로그번호
- HPA062391-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA062391-100 Anti-MYH14 Antibody, myosin, heavy chain 14, non-muscle 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA062391-25 Anti-MYH14 Antibody, myosin, heavy chain 14, non-muscle 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-MYH14 Antibody
Anti-MYH14 Antibody
Target: myosin, heavy chain 14, non-muscle
Supplier: Atlas Antibodies
Recommended Applications
Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against Human MYH14.
Alternative Gene Names
DFNA4, FLJ13881, KIAA2034, MHC16, MYH17
Target Information
- Target Protein: myosin, heavy chain 14, non-muscle
- Target Gene: MYH14
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
GAGEQLKADLLLEPCSHYRFLTNGPSSSPGQERELFQETLESLRVLGFSHEE
Verified Species Reactivity
Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000030739 | 94% |
| Rat | ENSRNOG00000020014 | 92% |
Antibody Properties
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using PrEST antigen |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



