Atlas Antibodies Anti-MYH10 Antibody

상품 한눈에 보기

Atlas Antibodies의 Anti-MYH10 항체는 인간 MYH10 단백질을 타겟으로 하는 고품질 폴리클로날 항체입니다. IHC 및 WB에서 RNA-seq 데이터 기반 정교한 Orthogonal 검증 수행. Rabbit IgG 형식으로 높은 특이성과 재현성을 제공합니다.

카탈로그번호: HPA057198-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA057198-100 Anti-MYH10 Antibody, myosin, heavy chain 10, non-muscle 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA057198-25 Anti-MYH10 Antibody, myosin, heavy chain 10, non-muscle 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-MYH10 Antibody

Anti-MYH10 Antibody

Target: myosin, heavy chain 10, non-muscle
Supplier: Atlas Antibodies

Recommended Applications

IHC (Orthogonal Validation): Protein expression validated by comparison to RNA-seq data in high and low expression tissues.
WB (Orthogonal Validation): Protein expression validated by comparison to RNA-seq data in high and low expression cell lines.

Product Description

Polyclonal Antibody against Human MYH10

Alternative Gene Names

NMMHCB

Target Information

항목	내용
Target Protein	myosin, heavy chain 10, non-muscle
Target Gene	MYH10
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Identity	Rat ENSRNOG00000002886 (97%) Mouse ENSMUSG00000020900 (96%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using PrEST antigen as affinity ligand

Antigen Sequence

RQLDDATEANEGLSREVSTLKNRLRRGGPISFSSSRSGRRQLHLEGASLELSDDDTESKTSDVNETQPPQ

Notes

Gently mix before use.
Optimal concentrations and conditions for each application should be determined by the user.
Material Safety Data Sheet
Open Datasheet